Lineage for d1sfyf_ (1sfy F:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. Protein Legume lectin [49904] (23 species)
  7. Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries)
    Uniprot P16404
  8. Domain d1sfyf_: 1sfy F: [105512]
    complexed with ca, mn

Details for d1sfyf_

PDB Entry: 1sfy (more details), 2.55 Å

PDB Description: crystal structure of recombinant erythrina corallodandron lectin
PDB Compounds: (F:) lectin

SCOPe Domain Sequences for d1sfyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfyf_ b.29.1.1 (F:) Legume lectin {Coral tree (Erythrina corallodendron) [TaxId: 3843]}
vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

SCOPe Domain Coordinates for d1sfyf_ are not available.

Timeline for d1sfyf_:

Domains from other chains:
(mouse over for more information)
d1sfya_, d1sfyb_, d1sfyc_, d1sfyd_, d1sfye_