Lineage for d1sfyd_ (1sfy D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1779938Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1780101Protein Legume lectin [49904] (23 species)
  7. 1780145Species Coral tree (Erythrina corallodendron) [TaxId:3843] [49908] (8 PDB entries)
    Uniprot P16404
  8. 1780157Domain d1sfyd_: 1sfy D: [105510]
    complexed with ca, lat, mn

Details for d1sfyd_

PDB Entry: 1sfy (more details), 2.55 Å

PDB Description: crystal structure of recombinant erythrina corallodandron lectin
PDB Compounds: (D:) lectin

SCOPe Domain Sequences for d1sfyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfyd_ b.29.1.1 (D:) Legume lectin {Coral tree (Erythrina corallodendron) [TaxId: 3843]}
vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe

SCOPe Domain Coordinates for d1sfyd_:

Click to download the PDB-style file with coordinates for d1sfyd_.
(The format of our PDB-style files is described here.)

Timeline for d1sfyd_: