Lineage for d1sfxb_ (1sfx B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 439135Family a.4.5.50: Hypothetical protein AF2008 [109680] (1 protein)
    The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families
  6. 439136Protein Hypothetical protein AF2008 [109681] (1 species)
  7. 439137Species Archaeoglobus fulgidus [TaxId:2234] [109682] (1 PDB entry)
  8. 439139Domain d1sfxb_: 1sfx B: [105506]
    Structural genomics target

Details for d1sfxb_

PDB Entry: 1sfx (more details), 1.55 Å

PDB Description: x-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus

SCOP Domain Sequences for d1sfxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfxb_ a.4.5.50 (B:) Hypothetical protein AF2008 {Archaeoglobus fulgidus}
snplgelvkaleklsfkpsdvriyslllerggmrvseiareldlsarfvrdrlkvllkrg
fvrreivekgwvgyiysaekpekvlkefkssilgeieriekmft

SCOP Domain Coordinates for d1sfxb_:

Click to download the PDB-style file with coordinates for d1sfxb_.
(The format of our PDB-style files is described here.)

Timeline for d1sfxb_: