Lineage for d1sfxb_ (1sfx B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983364Family a.4.5.50: TrmB-like [109680] (2 protein domains)
    The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families
  6. 1983365Protein Hypothetical protein AF2008 [109681] (1 species)
  7. 1983366Species Archaeoglobus fulgidus [TaxId:2234] [109682] (1 PDB entry)
    Uniprot O28271
  8. 1983368Domain d1sfxb_: 1sfx B: [105506]
    Other proteins in same PDB: d1sfxa2, d1sfxa3
    Structural genomics target
    complexed with cl, edo

Details for d1sfxb_

PDB Entry: 1sfx (more details), 1.55 Å

PDB Description: X-ray crystal structure of putative HTH transcription regulator from Archaeoglobus fulgidus
PDB Compounds: (B:) Conserved hypothetical protein AF2008

SCOPe Domain Sequences for d1sfxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfxb_ a.4.5.50 (B:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]}
snplgelvkaleklsfkpsdvriyslllerggmrvseiareldlsarfvrdrlkvllkrg
fvrreivekgwvgyiysaekpekvlkefkssilgeieriekmft

SCOPe Domain Coordinates for d1sfxb_:

Click to download the PDB-style file with coordinates for d1sfxb_.
(The format of our PDB-style files is described here.)

Timeline for d1sfxb_: