![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.50: TrmB-like [109680] (2 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families |
![]() | Protein Hypothetical protein AF2008 [109681] (1 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [109682] (1 PDB entry) Uniprot O28271 |
![]() | Domain d1sfxb_: 1sfx B: [105506] Other proteins in same PDB: d1sfxa2, d1sfxa3 Structural genomics target complexed with cl, edo |
PDB Entry: 1sfx (more details), 1.55 Å
SCOPe Domain Sequences for d1sfxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfxb_ a.4.5.50 (B:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} snplgelvkaleklsfkpsdvriyslllerggmrvseiareldlsarfvrdrlkvllkrg fvrreivekgwvgyiysaekpekvlkefkssilgeieriekmft
Timeline for d1sfxb_: