SCOPe 2.08: Domain d1sfxa1: 1sfx A:1-106

Lineage for d1sfxa1 (1sfx A:1-106)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.50: TrmB-like [109680] (2 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families

6. Protein Hypothetical protein AF2008 [109681] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [109682] (1 PDB entry)
   Uniprot O28271

8. Domain d1sfxa1: 1sfx A:1-106 [105505]
   Other proteins in same PDB: d1sfxa2, d1sfxa3
   Structural genomics target
   complexed with cl, edo

Details for d1sfxa1

PDB Entry: 1sfx, 1.55 Å

PDB Description: x-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus

PDB Compounds: (A:) Conserved hypothetical protein AF2008

SCOPe Domain Sequences for d1sfxa1:

Sequence; same for both SEQRES and ATOM records:

>d1sfxa1 a.4.5.50 (A:1-106) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]}
msnplgelvkaleklsfkpsdvriyslllerggmrvseiareldlsarfvrdrlkvllkr
gfvrreivekgwvgyiysaekpekvlkefkssilgeieriekmftd

Timeline for d1sfxa1:

• d1sfxa1 first appeared in SCOP 1.69, called d1sfxa_
  
• d1sfxa1 appears in SCOPe 2.07