Lineage for d1sfxa1 (1sfx A:1-106)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694220Family a.4.5.50: TrmB-like [109680] (2 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface, distinct from other known families
  6. 2694221Protein Hypothetical protein AF2008 [109681] (1 species)
  7. 2694222Species Archaeoglobus fulgidus [TaxId:2234] [109682] (1 PDB entry)
    Uniprot O28271
  8. 2694223Domain d1sfxa1: 1sfx A:1-106 [105505]
    Other proteins in same PDB: d1sfxa2, d1sfxa3
    Structural genomics target
    complexed with cl, edo

Details for d1sfxa1

PDB Entry: 1sfx (more details), 1.55 Å

PDB Description: x-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus
PDB Compounds: (A:) Conserved hypothetical protein AF2008

SCOPe Domain Sequences for d1sfxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfxa1 a.4.5.50 (A:1-106) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]}
msnplgelvkaleklsfkpsdvriyslllerggmrvseiareldlsarfvrdrlkvllkr
gfvrreivekgwvgyiysaekpekvlkefkssilgeieriekmftd

SCOPe Domain Coordinates for d1sfxa1:

Click to download the PDB-style file with coordinates for d1sfxa1.
(The format of our PDB-style files is described here.)

Timeline for d1sfxa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sfxb_