SCOPe 2.08: Domain d1sfub_: 1sfu B:

Lineage for d1sfub_ (1sfu B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
   Pfam PF02295

6. Protein 34L [109669] (1 species)

7. Species Yaba-like disease virus, YLDV [TaxId:132475] [109670] (1 PDB entry)
   Uniprot Q9DHS8 1-75

8. Domain d1sfub_: 1sfu B: [105504]
   protein/DNA complex

Details for d1sfub_

PDB Entry: 1sfu, 2 Å

PDB Description: Crystal structure of the viral Zalpha domain bound to left-handed Z-DNA

PDB Compounds: (B:) 34L protein

SCOPe Domain Sequences for d1sfub_:

Sequence; same for both SEQRES and ATOM records:

>d1sfub_ a.4.5.19 (B:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]}
ctvndaeifslvkkevlslntndyttaislsnrlkinkkkinqqlyklqkedtvkmvpsn
ppkwfknync

Timeline for d1sfub_:

• d1sfub_ first appeared in SCOP 1.69
  
• d1sfub_ appears in SCOPe 2.07