Lineage for d1sfua_ (1sfu A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 438099Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 438531Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) (S)
    contains a small beta-sheet (wing)
  5. 438747Family a.4.5.19: Z-DNA binding domain [46853] (4 proteins)
    Pfam 02295
  6. 438748Protein 34L [109669] (1 species)
  7. 438749Species Yaba-like disease virus, YLDV [TaxId:132475] [109670] (1 PDB entry)
  8. 438750Domain d1sfua_: 1sfu A: [105503]

Details for d1sfua_

PDB Entry: 1sfu (more details), 2 Å

PDB Description: Crystal structure of the viral Zalpha domain bound to left-handed Z-DNA

SCOP Domain Sequences for d1sfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV}
ctvndaeifslvkkevlslntndyttaislsnrlkinkkkinqqlyklqkedtvkmvpsn
ppkwfknync

SCOP Domain Coordinates for d1sfua_:

Click to download the PDB-style file with coordinates for d1sfua_.
(The format of our PDB-style files is described here.)

Timeline for d1sfua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sfub_