Lineage for d1sfua_ (1sfu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693367Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
    Pfam PF02295
  6. 2693368Protein 34L [109669] (1 species)
  7. 2693369Species Yaba-like disease virus, YLDV [TaxId:132475] [109670] (1 PDB entry)
    Uniprot Q9DHS8 1-75
  8. 2693370Domain d1sfua_: 1sfu A: [105503]
    protein/DNA complex

Details for d1sfua_

PDB Entry: 1sfu (more details), 2 Å

PDB Description: Crystal structure of the viral Zalpha domain bound to left-handed Z-DNA
PDB Compounds: (A:) 34L protein

SCOPe Domain Sequences for d1sfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]}
ctvndaeifslvkkevlslntndyttaislsnrlkinkkkinqqlyklqkedtvkmvpsn
ppkwfknync

SCOPe Domain Coordinates for d1sfua_:

Click to download the PDB-style file with coordinates for d1sfua_.
(The format of our PDB-style files is described here.)

Timeline for d1sfua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sfub_