Lineage for d1sfrb_ (1sfr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900132Family c.69.1.3: Mycobacterial antigens [53491] (5 proteins)
    automatically mapped to Pfam PF00756
  6. 2900133Protein Antigen 85a [110691] (1 species)
  7. 2900134Species Mycobacterium tuberculosis [TaxId:1773] [110692] (1 PDB entry)
    Uniprot P17944 43-330
  8. 2900136Domain d1sfrb_: 1sfr B: [105501]

Details for d1sfrb_

PDB Entry: 1sfr (more details), 2.7 Å

PDB Description: Crystal Structure of the Mycobacterium tuberculosis Antigen 85A Protein
PDB Compounds: (B:) Antigen 85-A

SCOPe Domain Sequences for d1sfrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfrb_ c.69.1.3 (B:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]}
afsrpglpveylqvpspsmgrdikvqfqsgganspalylldglraqddfsgwdintpafe
wydqsglsvvmpvggqssfysdwyqpacgkagcqtykwetfltselpgwlqanrhvkptg
savvglsmaassaltlaiyhpqqfvyagamsglldpsqamgptliglamgdaggykasdm
wgpkedpawqrndpllnvgklianntrvwvycgngkpsdlggnnlpakflegfvrtsnik
fqdaynaggghngvfdfpdsgthsweywgaqlnamkpdlqralgatpn

SCOPe Domain Coordinates for d1sfrb_:

Click to download the PDB-style file with coordinates for d1sfrb_.
(The format of our PDB-style files is described here.)

Timeline for d1sfrb_: