Lineage for d1sfra_ (1sfr A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 841866Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 841867Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 842159Family c.69.1.3: Mycobacterial antigens [53491] (4 proteins)
  6. 842160Protein Antigen 85a [110691] (1 species)
  7. 842161Species Mycobacterium tuberculosis [TaxId:1773] [110692] (1 PDB entry)
    Uniprot P17944 43-330
  8. 842162Domain d1sfra_: 1sfr A: [105500]

Details for d1sfra_

PDB Entry: 1sfr (more details), 2.7 Å

PDB Description: Crystal Structure of the Mycobacterium tuberculosis Antigen 85A Protein
PDB Compounds: (A:) Antigen 85-A

SCOP Domain Sequences for d1sfra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]}
afsrpglpveylqvpspsmgrdikvqfqsgganspalylldglraqddfsgwdintpafe
wydqsglsvvmpvggqssfysdwyqpacgkagcqtykwetfltselpgwlqanrhvkptg
savvglsmaassaltlaiyhpqqfvyagamsglldpsqamgptliglamgdaggykasdm
wgpkedpawqrndpllnvgklianntrvwvycgngkpsdlggnnlpakflegfvrtsnik
fqdaynaggghngvfdfpdsgthsweywgaqlnamkpdlqralgatpn

SCOP Domain Coordinates for d1sfra_:

Click to download the PDB-style file with coordinates for d1sfra_.
(The format of our PDB-style files is described here.)

Timeline for d1sfra_: