Lineage for d1sfq.2 (1sfq D:,E:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)
  6. 465597Protein Thrombin [50531] (2 species)
  7. 465598Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries)
  8. 465602Domain d1sfq.2: 1sfq D:,E: [105499]

Details for d1sfq.2

PDB Entry: 1sfq (more details), 1.91 Å

PDB Description: fast form of thrombin mutant r(77a)a bound to ppack

SCOP Domain Sequences for d1sfq.2:

Sequence, based on SEQRES records: (download)

>g1sfq.2 b.47.1.2 (D:,E:) Thrombin {Cow (Bos taurus)}
adcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcgas
lisdrwvltaahcllyppwdknftendllvrigkhsrtryeaniekismlekiyihpryn
wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtan
vgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvm
kspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

Sequence, based on observed residues (ATOM records): (download)

>g1sfq.2 b.47.1.2 (D:,E:) Thrombin {Cow (Bos taurus)}
adcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcgas
lisdrwvltaahcllyppwdknftendllvrigkhsrtryeaniekismlekiyihpryn
wrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwgqp
svlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnn
rwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

SCOP Domain Coordinates for d1sfq.2:

Click to download the PDB-style file with coordinates for d1sfq.2.
(The format of our PDB-style files is described here.)

Timeline for d1sfq.2: