Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Thrombin [50531] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries) Uniprot P00734 333-622 |
Domain d1sfq.1: 1sfq A:,B: [105498] complexed with 0g6, na, nag; mutant |
PDB Entry: 1sfq (more details), 1.91 Å
SCOPe Domain Sequences for d1sfq.1:
Sequence, based on SEQRES records: (download)
>g1sfq.1 b.47.1.2 (A:,B:) Thrombin {Cow (Bos taurus) [TaxId: 9913]} eadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcga slisdrwvltaahcllyppwdknftendllvrigkhsrtryeaniekismlekiyihpry nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwta nvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf
>g1sfq.1 b.47.1.2 (A:,B:) Thrombin {Cow (Bos taurus) [TaxId: 9913]} eadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcga slisdrwvltaahcllyppwdknftendllvrigkhsrtryeaniekismlekiyihpry nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwgq psvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfn nrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf
Timeline for d1sfq.1:
View in 3D Domains from other chains: (mouse over for more information) d1sfq.2, d1sfq.2, d1sfq.2, d1sfq.2 |