SCOPe 2.06: Domain d1sfnb_: 1sfn B:

Lineage for d1sfnb_ (1sfn B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.11: YlbA-like [101979] (4 proteins)
   Pfam PF05899; formerly pfam06038; duplication: consists of two germin-like domains

6. Protein Hypothetical protein DR1152 [110316] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [110317] (1 PDB entry)
   Uniprot Q9RV77

8. Domain d1sfnb_: 1sfn B: [105497]
   Structural genomics target

Details for d1sfnb_

PDB Entry: 1sfn, 2.46 Å

PDB Description: crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1sfnb_:

Sequence; same for both SEQRES and ATOM records:

>d1sfnb_ b.82.1.11 (B:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]}
mkhlgqtrsalhgshavitpetfvrtalaewpgsaivlhiapvvglgarfvqftaempag
aqatesvyqrfafvlsgevdvavggetrtlreydyvylpagekhmltaktdarvsvfekp
yqtvegvqapgvywgnerenpgypfegddhliarkllpdepafdfmvstmsfapgaslpy
aevhymehgllmlegeglykleenyypvtagdiiwmgahcpqwygalgrnwskyllykdm
nrhpl

Timeline for d1sfnb_:

• d1sfnb_ first appeared in SCOP 1.69
  
• d1sfnb_ appears in SCOPe 2.05
  
• d1sfnb_ appears in SCOPe 2.07
  
• d1sfnb_ appears in the current release, SCOPe 2.08