Lineage for d1sfnb_ (1sfn B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677267Superfamily b.82.1: RmlC-like cupins [51182] (20 families) (S)
  5. 677559Family b.82.1.11: YlbA-like [101979] (4 proteins)
    Pfam PF05899; formerly pfam06038; duplication: consists of two germin-like domains
  6. 677564Protein Hypothetical protein DR1152 [110316] (1 species)
  7. 677565Species Deinococcus radiodurans [TaxId:1299] [110317] (1 PDB entry)
  8. 677567Domain d1sfnb_: 1sfn B: [105497]
    Structural genomics target

Details for d1sfnb_

PDB Entry: 1sfn (more details), 2.46 Å

PDB Description: crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861
PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d1sfnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfnb_ b.82.1.11 (B:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]}
mkhlgqtrsalhgshavitpetfvrtalaewpgsaivlhiapvvglgarfvqftaempag
aqatesvyqrfafvlsgevdvavggetrtlreydyvylpagekhmltaktdarvsvfekp
yqtvegvqapgvywgnerenpgypfegddhliarkllpdepafdfmvstmsfapgaslpy
aevhymehgllmlegeglykleenyypvtagdiiwmgahcpqwygalgrnwskyllykdm
nrhpl

SCOP Domain Coordinates for d1sfnb_:

Click to download the PDB-style file with coordinates for d1sfnb_.
(The format of our PDB-style files is described here.)

Timeline for d1sfnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sfna_