Lineage for d1sfnb_ (1sfn B:)
- Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.1: RmlC-like cupins [51182] (13 families) 
Family b.82.1.11: YlbA-like [101979] (4 proteins)
Pfam 05899; formerly pfam06038
duplication: consists of two germin-like domains
Protein Hypothetical protein DR1152 [110316] (1 species) Species Deinococcus radiodurans [TaxId:1299] [110317] (1 PDB entry) 
Domain d1sfnb_: 1sfn B: [105497]
Structural genomics target
Details for d1sfnb_
PDB Entry: 1sfn (more details), 2.46 Å
PDB Description: crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861
SCOP Domain Sequences for d1sfnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfnb_ b.82.1.11 (B:) Hypothetical protein DR1152 {Deinococcus radiodurans}
mkhlgqtrsalhgshavitpetfvrtalaewpgsaivlhiapvvglgarfvqftaempag
aqatesvyqrfafvlsgevdvavggetrtlreydyvylpagekhmltaktdarvsvfekp
yqtvegvqapgvywgnerenpgypfegddhliarkllpdepafdfmvstmsfapgaslpy
aevhymehgllmlegeglykleenyypvtagdiiwmgahcpqwygalgrnwskyllykdm
nrhpl
SCOP Domain Coordinates for d1sfnb_:
Click to download the PDB-style file with coordinates for d1sfnb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sfnb_:
- d1sfnb_ is new in SCOP 1.69
- d1sfnb_ appears in SCOP 1.71
- d1sfnb_ appears in the current release, SCOPe 2.08
View in 3D
