SCOPe 2.08: Domain d1sfkh_: 1sfk H:

Lineage for d1sfkh_ (1sfk H:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
   core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices

4. Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families)
   automatically mapped to Pfam PF01003

5. Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein)

6. Protein Flavivirus capsid protein C [101259] (3 species)

7. Species Kunjin virus [TaxId:11077] [109878] (1 PDB entry)
   Uniprot P14335 23-98

8. Domain d1sfkh_: 1sfk H: [105495]
   complexed with ca, cl, pg4, po4

Details for d1sfkh_

PDB Entry: 1sfk, 3.2 Å

PDB Description: Core (C) protein from West Nile Virus, subtype Kunjin

PDB Compounds: (H:) Core protein

SCOPe Domain Sequences for d1sfkh_:

Sequence; same for both SEQRES and ATOM records:

>d1sfkh_ a.190.1.1 (H:) Flavivirus capsid protein C {Kunjin virus [TaxId: 11077]}
grgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsfkkelgtltsainr

Timeline for d1sfkh_:

• d1sfkh_ first appeared in SCOP 1.69
  
• d1sfkh_ appears in SCOPe 2.07