Lineage for d1sfkg_ (1sfk G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752965Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
    core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices
  4. 1752966Superfamily a.190.1: Flavivirus capsid protein C [101257] (1 family) (S)
    automatically mapped to Pfam PF01003
  5. 1752967Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein)
  6. 1752968Protein Flavivirus capsid protein C [101259] (2 species)
  7. 1752972Species Kunjin virus [TaxId:11077] [109878] (1 PDB entry)
    Uniprot P14335 23-98
  8. 1752979Domain d1sfkg_: 1sfk G: [105494]
    complexed with ca, cl, pg4, po4

Details for d1sfkg_

PDB Entry: 1sfk (more details), 3.2 Å

PDB Description: Core (C) protein from West Nile Virus, subtype Kunjin
PDB Compounds: (G:) Core protein

SCOPe Domain Sequences for d1sfkg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfkg_ a.190.1.1 (G:) Flavivirus capsid protein C {Kunjin virus [TaxId: 11077]}
lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf
kkelgtltsainr

SCOPe Domain Coordinates for d1sfkg_:

Click to download the PDB-style file with coordinates for d1sfkg_.
(The format of our PDB-style files is described here.)

Timeline for d1sfkg_: