Class a: All alpha proteins [46456] (226 folds) |
Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily) core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices |
Superfamily a.190.1: Flavivirus capsid protein C [101257] (1 family) |
Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein) |
Protein Flavivirus capsid protein C [101259] (2 species) |
Species Kunjin virus [TaxId:11077] [109878] (1 PDB entry) |
Domain d1sfkg_: 1sfk G: [105494] |
PDB Entry: 1sfk (more details), 3.2 Å
SCOP Domain Sequences for d1sfkg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfkg_ a.190.1.1 (G:) Flavivirus capsid protein C {Kunjin virus} lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf kkelgtltsainr
Timeline for d1sfkg_: