Lineage for d1sfkg_ (1sfk G:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 545854Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
    core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices
  4. 545855Superfamily a.190.1: Flavivirus capsid protein C [101257] (1 family) (S)
  5. 545856Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein)
  6. 545857Protein Flavivirus capsid protein C [101259] (2 species)
  7. 545861Species Kunjin virus [TaxId:11077] [109878] (1 PDB entry)
  8. 545868Domain d1sfkg_: 1sfk G: [105494]

Details for d1sfkg_

PDB Entry: 1sfk (more details), 3.2 Å

PDB Description: Core (C) protein from West Nile Virus, subtype Kunjin

SCOP Domain Sequences for d1sfkg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfkg_ a.190.1.1 (G:) Flavivirus capsid protein C {Kunjin virus}
lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf
kkelgtltsainr

SCOP Domain Coordinates for d1sfkg_:

Click to download the PDB-style file with coordinates for d1sfkg_.
(The format of our PDB-style files is described here.)

Timeline for d1sfkg_: