Lineage for d1sfke_ (1sfk E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014489Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
    core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices
  4. 2014490Superfamily a.190.1: Flavivirus capsid protein C [101257] (1 family) (S)
    automatically mapped to Pfam PF01003
  5. 2014491Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein)
  6. 2014492Protein Flavivirus capsid protein C [101259] (2 species)
  7. 2014496Species Kunjin virus [TaxId:11077] [109878] (1 PDB entry)
    Uniprot P14335 23-98
  8. 2014501Domain d1sfke_: 1sfk E: [105492]
    complexed with ca, cl, pg4, po4

Details for d1sfke_

PDB Entry: 1sfk (more details), 3.2 Å

PDB Description: Core (C) protein from West Nile Virus, subtype Kunjin
PDB Compounds: (E:) Core protein

SCOPe Domain Sequences for d1sfke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfke_ a.190.1.1 (E:) Flavivirus capsid protein C {Kunjin virus [TaxId: 11077]}
lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf
kkelgtltsainr

SCOPe Domain Coordinates for d1sfke_:

Click to download the PDB-style file with coordinates for d1sfke_.
(The format of our PDB-style files is described here.)

Timeline for d1sfke_: