![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily) core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices |
![]() | Superfamily a.190.1: Flavivirus capsid protein C [101257] (2 families) ![]() automatically mapped to Pfam PF01003 |
![]() | Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein) |
![]() | Protein Flavivirus capsid protein C [101259] (3 species) |
![]() | Species Kunjin virus [TaxId:11077] [109878] (1 PDB entry) Uniprot P14335 23-98 |
![]() | Domain d1sfkd_: 1sfk D: [105491] complexed with ca, cl, pg4, po4 |
PDB Entry: 1sfk (more details), 3.2 Å
SCOPe Domain Sequences for d1sfkd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfkd_ a.190.1.1 (D:) Flavivirus capsid protein C {Kunjin virus [TaxId: 11077]} lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf kkelgtltsainr
Timeline for d1sfkd_: