![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily) core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices |
![]() | Superfamily a.190.1: Flavivirus capsid protein C [101257] (1 family) ![]() |
![]() | Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein) |
![]() | Protein Flavivirus capsid protein C [101259] (2 species) |
![]() | Species Kunjin virus [TaxId:11077] [109878] (1 PDB entry) |
![]() | Domain d1sfka_: 1sfk A: [105488] |
PDB Entry: 1sfk (more details), 3.2 Å
SCOP Domain Sequences for d1sfka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sfka_ a.190.1.1 (A:) Flavivirus capsid protein C {Kunjin virus} lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf kkelgtltsainr
Timeline for d1sfka_: