Lineage for d1sfka_ (1sfk A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450372Fold a.190: Flavivirus capsid protein C [101256] (1 superfamily)
    core: 5 helices; right-handed superhelix; swapped dimer with the two long C-terminal helices
  4. 450373Superfamily a.190.1: Flavivirus capsid protein C [101257] (1 family) (S)
  5. 450374Family a.190.1.1: Flavivirus capsid protein C [101258] (1 protein)
  6. 450375Protein Flavivirus capsid protein C [101259] (2 species)
  7. 450379Species Kunjin virus [TaxId:11077] [109878] (1 PDB entry)
  8. 450380Domain d1sfka_: 1sfk A: [105488]

Details for d1sfka_

PDB Entry: 1sfk (more details), 3.2 Å

PDB Description: Core (C) protein from West Nile Virus, subtype Kunjin

SCOP Domain Sequences for d1sfka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfka_ a.190.1.1 (A:) Flavivirus capsid protein C {Kunjin virus}
lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf
kkelgtltsainr

SCOP Domain Coordinates for d1sfka_:

Click to download the PDB-style file with coordinates for d1sfka_.
(The format of our PDB-style files is described here.)

Timeline for d1sfka_: