SCOPe 2.05: Domain d1sfhb_: 1sfh B:

Lineage for d1sfhb_ (1sfh B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Amicyanin [49505] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
   Uniprot P22364

8. Domain d1sfhb_: 1sfh B: [105487]
   complexed with cu1, na; mutant

Details for d1sfhb_

PDB Entry: 1sfh, 1.05 Å

PDB Description: reduced state of amicyanin mutant p94f

PDB Compounds: (B:) amicyanin

SCOPe Domain Sequences for d1sfhb_:

Sequence; same for both SEQRES and ATOM records:

>d1sfhb_ b.6.1.1 (B:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctfhpfmrgkvvve

Timeline for d1sfhb_:

• d1sfhb_ first appeared in SCOP 1.69
  
• d1sfhb_ appears in SCOPe 2.04
  
• d1sfhb_ appears in SCOPe 2.06
  
• d1sfhb_ appears in the current release, SCOPe 2.08