Lineage for d1sfhb_ (1sfh B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770401Protein Amicyanin [49505] (2 species)
  7. 2770402Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 2770411Domain d1sfhb_: 1sfh B: [105487]
    complexed with cu1, na; mutant

Details for d1sfhb_

PDB Entry: 1sfh (more details), 1.05 Å

PDB Description: reduced state of amicyanin mutant p94f
PDB Compounds: (B:) amicyanin

SCOPe Domain Sequences for d1sfhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sfhb_ b.6.1.1 (B:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctfhpfmrgkvvve

SCOPe Domain Coordinates for d1sfhb_:

Click to download the PDB-style file with coordinates for d1sfhb_.
(The format of our PDB-style files is described here.)

Timeline for d1sfhb_: