Lineage for d1sffb_ (1sff B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490721Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 490722Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 491163Family c.67.1.4: GABA-aminotransferase-like [53417] (13 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 491182Protein 4-aminobutyrate aminotransferase, GABA-aminotransferase [53424] (2 species)
  7. 491183Species Escherichia coli [TaxId:562] [110686] (2 PDB entries)
  8. 491185Domain d1sffb_: 1sff B: [105483]

Details for d1sffb_

PDB Entry: 1sff (more details), 1.9 Å

PDB Description: Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate

SCOP Domain Sequences for d1sffb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sffb_ c.67.1.4 (B:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli}
nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
deakq

SCOP Domain Coordinates for d1sffb_:

Click to download the PDB-style file with coordinates for d1sffb_.
(The format of our PDB-style files is described here.)

Timeline for d1sffb_: