Lineage for d1sf8f1 (1sf8 F:511-624)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009359Fold d.271: HSP90 C-terminal domain [110941] (1 superfamily)
    alpha-beta(3)-alpha(3); 2 layers, a/b; mixed beta-sheet, order:132; crossing loops
  4. 3009360Superfamily d.271.1: HSP90 C-terminal domain [110942] (1 family) (S)
    automatically mapped to Pfam PF00183
  5. 3009361Family d.271.1.1: HSP90 C-terminal domain [110943] (1 protein)
    C-terminal part of Pfam PF00183
  6. 3009362Protein Chaperone protein HtpG [110944] (1 species)
  7. 3009363Species Escherichia coli [TaxId:562] [110945] (1 PDB entry)
    Uniprot P10413 511-624
  8. 3009369Domain d1sf8f1: 1sf8 F:511-624 [105477]
    Other proteins in same PDB: d1sf8a2, d1sf8b2, d1sf8c2, d1sf8d2, d1sf8e2, d1sf8f2, d1sf8g2, d1sf8h2
    complexed with cl, ni

Details for d1sf8f1

PDB Entry: 1sf8 (more details), 2.6 Å

PDB Description: Crystal structure of the carboxy-terminal domain of htpG, the E. coli Hsp90
PDB Compounds: (F:) Chaperone protein htpG

SCOPe Domain Sequences for d1sf8f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sf8f1 d.271.1.1 (F:511-624) Chaperone protein HtpG {Escherichia coli [TaxId: 562]}
fidrvkallgervkdvrlthrltdtpaivstdademstqmaklfaaagqkvpevkyifel
npdhvlvkraadtedeakfsewvellldqallaergtledpnlfirrmnqllvs

SCOPe Domain Coordinates for d1sf8f1:

Click to download the PDB-style file with coordinates for d1sf8f1.
(The format of our PDB-style files is described here.)

Timeline for d1sf8f1: