Lineage for d1sf5a_ (1sf5 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 553581Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 553582Superfamily b.6.1: Cupredoxins [49503] (6 families) (S)
    contains copper-binding site
  5. 553583Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
    mono-domain proteins
  6. 553584Protein Amicyanin [49505] (2 species)
  7. 553585Species Paracoccus denitrificans [TaxId:266] [49506] (14 PDB entries)
  8. 553591Domain d1sf5a_: 1sf5 A: [105471]
    complexed with cu, mho; mutant

Details for d1sf5a_

PDB Entry: 1sf5 (more details), 1.1 Å

PDB Description: structure of oxidized state of the p94a mutant of amicyanin

SCOP Domain Sequences for d1sf5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sf5a_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctahpfmrgkvvve

SCOP Domain Coordinates for d1sf5a_:

Click to download the PDB-style file with coordinates for d1sf5a_.
(The format of our PDB-style files is described here.)

Timeline for d1sf5a_: