Lineage for d1sf3a_ (1sf3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770401Protein Amicyanin [49505] (2 species)
  7. 2770402Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 2770409Domain d1sf3a_: 1sf3 A: [105470]
    complexed with cu1, po4; mutant

Details for d1sf3a_

PDB Entry: 1sf3 (more details), 1.05 Å

PDB Description: structure of the reduced form of the p94a mutant of amicyanin
PDB Compounds: (A:) amicyanin

SCOPe Domain Sequences for d1sf3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sf3a_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctahpfmrgkvvve

SCOPe Domain Coordinates for d1sf3a_:

Click to download the PDB-style file with coordinates for d1sf3a_.
(The format of our PDB-style files is described here.)

Timeline for d1sf3a_: