Lineage for d1sf2a_ (1sf2 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589118Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 589119Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 589581Family c.67.1.4: GABA-aminotransferase-like [53417] (13 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 589600Protein 4-aminobutyrate aminotransferase, GABA-aminotransferase [53424] (2 species)
  7. 589601Species Escherichia coli [TaxId:562] [110686] (2 PDB entries)
  8. 589606Domain d1sf2a_: 1sf2 A: [105466]

Details for d1sf2a_

PDB Entry: 1sf2 (more details), 2.4 Å

PDB Description: structure of e. coli gamma-aminobutyrate aminotransferase

SCOP Domain Sequences for d1sf2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sf2a_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli}
nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
deakq

SCOP Domain Coordinates for d1sf2a_:

Click to download the PDB-style file with coordinates for d1sf2a_.
(The format of our PDB-style files is described here.)

Timeline for d1sf2a_: