Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (15 families) |
Family c.47.1.1: Thioltransferase [52834] (11 proteins) |
Protein Thioredoxin-like protein p19, TLP19 [110604] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110605] (1 PDB entry) |
Domain d1sena_: 1sen A: [105465] Structural genomics target |
PDB Entry: 1sen (more details), 1.2 Å
SCOP Domain Sequences for d1sena_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens)} lgkgfgdhihwrtledgkkeaaasglplmviihkswcgackalkpkfaesteiselshnf vmvnledeeepkdedfspdggyiprilfldpsgkvhpeiinengnpsykyfyvsaeqvvq gmkeaqerltgdafr
Timeline for d1sena_: