Lineage for d1sena_ (1sen A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876436Protein Thioredoxin-like protein p19, TLP19 [110604] (1 species)
  7. 2876437Species Human (Homo sapiens) [TaxId:9606] [110605] (1 PDB entry)
    Uniprot O95881 23-172
  8. 2876438Domain d1sena_: 1sen A: [105465]
    Structural genomics target
    complexed with cl, pt

Details for d1sena_

PDB Entry: 1sen (more details), 1.2 Å

PDB Description: endoplasmic reticulum protein rp19 o95881
PDB Compounds: (A:) Thioredoxin-like protein p19

SCOPe Domain Sequences for d1sena_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]}
lgkgfgdhihwrtledgkkeaaasglplmviihkswcgackalkpkfaesteiselshnf
vmvnledeeepkdedfspdggyiprilfldpsgkvhpeiinengnpsykyfyvsaeqvvq
gmkeaqerltgdafr

SCOPe Domain Coordinates for d1sena_:

Click to download the PDB-style file with coordinates for d1sena_.
(The format of our PDB-style files is described here.)

Timeline for d1sena_: