Lineage for d1seje1 (1sej E:3-180)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1384489Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1384490Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1384491Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1384492Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 1384493Species Cryptosporidium hominis [TaxId:237895] [102636] (3 PDB entries)
    Uniprot Q5CGA3 Q27552
  8. 1384508Domain d1seje1: 1sej E:3-180 [105463]
    Other proteins in same PDB: d1seja2, d1sejb2, d1sejc2, d1sejd2, d1seje2
    complexed with f89, ndp, ump

Details for d1seje1

PDB Entry: 1sej (more details), 2.87 Å

PDB Description: crystal structure of dihydrofolate reductase-thymidylate synthase from cryptosporidium hominis bound to 1843u89/nadph/dump
PDB Compounds: (E:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d1seje1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seje1 c.71.1.1 (E:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOPe Domain Coordinates for d1seje1:

Click to download the PDB-style file with coordinates for d1seje1.
(The format of our PDB-style files is described here.)

Timeline for d1seje1: