SCOP 1.69: Domain d1seje1: 1sej E:3-180

Lineage for d1seje1 (1sej E:3-180)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (3 species)

7. Species Cryptosporidium hominis [TaxId:237895] [110705] (1 PDB entry)

8. Domain d1seje1: 1sej E:3-180 [105463]
   Other proteins in same PDB: d1seja2, d1sejb2, d1sejc2, d1sejd2, d1seje2

Details for d1seje1

PDB Entry: 1sej, 2.87 Å

PDB Description: crystal structure of dihydrofolate reductase-thymidylate synthase from cryptosporidium hominis bound to 1843u89/nadph/dump

SCOP Domain Sequences for d1seje1:

Sequence; same for both SEQRES and ATOM records:

>d1seje1 c.71.1.1 (E:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

Timeline for d1seje1:

• d1seje1 is new in SCOP 1.69
  
• d1seje1 appears in SCOP 1.71
  
• d1seje1 appears in the current release, SCOPe 2.08