Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.71: Dihydrofolate reductases [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) |
Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) |
Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (3 species) |
Species Cryptosporidium hominis [TaxId:237895] [110705] (1 PDB entry) |
Domain d1seje1: 1sej E:3-180 [105463] Other proteins in same PDB: d1seja2, d1sejb2, d1sejc2, d1sejd2, d1seje2 |
PDB Entry: 1sej (more details), 2.87 Å
SCOP Domain Sequences for d1seje1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1seje1 c.71.1.1 (E:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis} eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
Timeline for d1seje1: