Lineage for d1sejc1 (1sej C:3-180)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843142Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 843143Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) (S)
  5. 843144Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 843145Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 843146Species Cryptosporidium hominis [TaxId:237895] [102636] (3 PDB entries)
    Uniprot Q5CGA3 Q27552
  8. 843149Domain d1sejc1: 1sej C:3-180 [105459]
    Other proteins in same PDB: d1seja2, d1sejb2, d1sejc2, d1sejd2, d1seje2

Details for d1sejc1

PDB Entry: 1sej (more details), 2.87 Å

PDB Description: crystal structure of dihydrofolate reductase-thymidylate synthase from cryptosporidium hominis bound to 1843u89/nadph/dump
PDB Compounds: (C:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOP Domain Sequences for d1sejc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sejc1 c.71.1.1 (C:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

SCOP Domain Coordinates for d1sejc1:

Click to download the PDB-style file with coordinates for d1sejc1.
(The format of our PDB-style files is described here.)

Timeline for d1sejc1: