SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1seja2 (1sej A:181-521)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428979Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1428980Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1428981Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 protein domains)
  6. 1428982Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain [55841] (2 species)
  7. Species Cryptosporidium hominis [TaxId:237895] [100887] (3 PDB entries)
  8. 1428994Domain d1seja2: 1sej A:181-521 [105456]
    Other proteins in same PDB: d1seja1, d1sejb1, d1sejc1, d1sejd1, d1seje1
    Q5CGA3 Q27552
    complexed with f89, ndp, ump

Details for d1seja2

PDB Entry: 1sej (more details), 2.87 Å

PDB Description: Crystal Structure of Dihydrofolate Reductase-Thymidylate Synthase from Cryptosporidium hominis Bound to 1843U89/NADPH/dUMP
PDB Compounds: (A:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d1seja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seja2 d.117.1.1 (A:181-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]}
ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
prpfpqlkfkrkveniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d1seja2:

Click to download the PDB-style file with coordinates for d1seja2.
(The format of our PDB-style files is described here.)

Timeline for d1seja2: