Lineage for d1seja2 (1sej A:181-521)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1428979Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1428980Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 1428981Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1428982Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain [55841] (2 species)
  7. Species Cryptosporidium hominis [TaxId:237895] [100887] (3 PDB entries)
  8. 1428994Domain d1seja2: 1sej A:181-521 [105456]
    Other proteins in same PDB: d1seja1, d1sejb1, d1sejc1, d1sejd1, d1seje1
    Q5CGA3 Q27552
    complexed with f89, ndp, ump

Details for d1seja2

PDB Entry: 1sej (more details), 2.87 Å

PDB Description: crystal structure of dihydrofolate reductase-thymidylate synthase from cryptosporidium hominis bound to 1843u89/nadph/dump
PDB Compounds: (A:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d1seja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1seja2 d.117.1.1 (A:181-521) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]}
ktlqncdpargqlksiddtvdllgeifgirkmgnrhkfpkeeiyntpsirfgrehyefqy
ldllsrvlengayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfik
gdtngnhliekkvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddy
tgvgvdqlaklietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnl
yqrscdlglgspfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrt
prpfpqlkfkrkveniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d1seja2:

Click to download the PDB-style file with coordinates for d1seja2.
(The format of our PDB-style files is described here.)

Timeline for d1seja2: