![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins) |
![]() | Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species) |
![]() | Species Cryptosporidium hominis [TaxId:237895] [102636] (3 PDB entries) Uniprot Q5CGA3 Q27552 |
![]() | Domain d1seja1: 1sej A:3-180 [105455] Other proteins in same PDB: d1seja2, d1sejb2, d1sejc2, d1sejd2, d1seje2 |
PDB Entry: 1sej (more details), 2.87 Å
SCOP Domain Sequences for d1seja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1seja1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]} eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek
Timeline for d1seja1: