![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
![]() | Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
![]() | Protein Scorpion toxin [57097] (17 species) |
![]() | Species Scorpion (Androctonus australis hector), Toxin II [TaxId:70175] [57102] (4 PDB entries) Uniprot P01484 |
![]() | Domain d1sega_: 1seg A: [105453] Aah2: chimeric toxin complexed with no3, ppi, so4 |
PDB Entry: 1seg (more details), 1.3 Å
SCOPe Domain Sequences for d1sega_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sega_ g.3.7.1 (A:) Scorpion toxin {Scorpion (Androctonus australis hector), Toxin II [TaxId: 70175]} vkdgyivknynctyfcfrnaycneectklkgesgycqwaspygnacycyklpdhvpirvp gkch
Timeline for d1sega_: