Lineage for d1sega_ (1seg A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635215Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 2635231Protein Scorpion toxin [57097] (17 species)
  7. 2635286Species Scorpion (Androctonus australis hector), Toxin II [TaxId:70175] [57102] (4 PDB entries)
    Uniprot P01484
  8. 2635292Domain d1sega_: 1seg A: [105453]
    Aah2: chimeric toxin
    complexed with no3, ppi, so4

Details for d1sega_

PDB Entry: 1seg (more details), 1.3 Å

PDB Description: crystal structure of a toxin chimera between lqh-alpha-it from the scorpion leiurus quinquestriatus hebraeus and aah2 from androctonus australis hector
PDB Compounds: (A:) aah2: lqh-alpha-it (face) chimeric toxin

SCOPe Domain Sequences for d1sega_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sega_ g.3.7.1 (A:) Scorpion toxin {Scorpion (Androctonus australis hector), Toxin II [TaxId: 70175]}
vkdgyivknynctyfcfrnaycneectklkgesgycqwaspygnacycyklpdhvpirvp
gkch

SCOPe Domain Coordinates for d1sega_:

Click to download the PDB-style file with coordinates for d1sega_.
(The format of our PDB-style files is described here.)

Timeline for d1sega_: