SCOPe 2.07: Domain d1sefa_: 1sef A:

Lineage for d1sefa_ (1sef A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.11: YlbA-like [101979] (4 proteins)
   Pfam PF05899; formerly pfam06038; duplication: consists of two germin-like domains

6. Protein Hypothetical protein EF2996 [110314] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [110315] (1 PDB entry)
   Uniprot Q82ZQ3

8. Domain d1sefa_: 1sef A: [105452]
   Structural genomics target

Details for d1sefa_

PDB Entry: 1sef, 2.05 Å

PDB Description: crystal structure of cupin domain protein ef2996 from enterococcus faecalis

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1sefa_:

Sequence; same for both SEQRES and ATOM records:

>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]}
kelltsravikkdnyaiiphdglvqnavpgfenvdisilgspklgatfvdyiatfhkngq
qttgfggdgiqtlvyvidgrlrvsdgqetheleaggyayftpemkmylanaqeadtevfl
ykkryqplaghqpykvvgsihdqqpeeyegmtdvllwsllpkefdfdmnmhilsfepgas
hayiethvqehgaylisgqgmynldnewypvekgdyifmsayvpqaayavgreeplmyvy
skdanrepel

Timeline for d1sefa_:

• d1sefa_ first appeared in SCOP 1.69
  
• d1sefa_ appears in SCOPe 2.06
  
• d1sefa_ appears in the current release, SCOPe 2.08