![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (24 families) ![]() |
![]() | Family b.82.1.11: YlbA-like [101979] (4 proteins) Pfam PF05899; formerly pfam06038; duplication: consists of two germin-like domains |
![]() | Protein Hypothetical protein EF2996 [110314] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [110315] (1 PDB entry) Uniprot Q82ZQ3 |
![]() | Domain d1sefa_: 1sef A: [105452] Structural genomics target |
PDB Entry: 1sef (more details), 2.05 Å
SCOP Domain Sequences for d1sefa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} kelltsravikkdnyaiiphdglvqnavpgfenvdisilgspklgatfvdyiatfhkngq qttgfggdgiqtlvyvidgrlrvsdgqetheleaggyayftpemkmylanaqeadtevfl ykkryqplaghqpykvvgsihdqqpeeyegmtdvllwsllpkefdfdmnmhilsfepgas hayiethvqehgaylisgqgmynldnewypvekgdyifmsayvpqaayavgreeplmyvy skdanrepel
Timeline for d1sefa_: