![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.219: Hypothetical protein YhaI [109914] (1 superfamily) core: 5 helices; orthogonal array; folding similarity to the TipA-S domain (1ny9) |
![]() | Superfamily a.219.1: Hypothetical protein YhaI [109915] (1 family) ![]() oligomerizes via extra N-terminal helix forming trimeric coil-coiled automatically mapped to Pfam PF08963 |
![]() | Family a.219.1.1: Hypothetical protein YhaI [109916] (1 protein) |
![]() | Protein Hypothetical protein YhaI [109917] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [109918] (1 PDB entry) Uniprot O07517 |
![]() | Domain d1sedc_: 1sed C: [105451] Structural genomics target complexed with gol, mpd, na, zn |
PDB Entry: 1sed (more details), 2.1 Å
SCOPe Domain Sequences for d1sedc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sedc_ a.219.1.1 (C:) Hypothetical protein YhaI {Bacillus subtilis [TaxId: 1423]} dsmdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseelatqk aqgfvtfdkllalfagqlnekldvhetifalyeqglyqelmevfidimkhfd
Timeline for d1sedc_: