Lineage for d1sedb_ (1sed B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450705Fold a.219: Hypothetical protein YhaI [109914] (1 superfamily)
    core: 5 helices; orthogonal array; folding similarity to the TipA-S domain (1ny9)
  4. 450706Superfamily a.219.1: Hypothetical protein YhaI [109915] (1 family) (S)
    oligomerizes via extra N-terminal helix forming trimeric coil-coiled
  5. 450707Family a.219.1.1: Hypothetical protein YhaI [109916] (1 protein)
  6. 450708Protein Hypothetical protein YhaI [109917] (1 species)
  7. 450709Species Bacillus subtilis [TaxId:1423] [109918] (1 PDB entry)
  8. 450711Domain d1sedb_: 1sed B: [105450]

Details for d1sedb_

PDB Entry: 1sed (more details), 2.1 Å

PDB Description: Crystal Structure of Protein of Unknown Function YhaL from Bacillus subtilis

SCOP Domain Sequences for d1sedb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sedb_ a.219.1.1 (B:) Hypothetical protein YhaI {Bacillus subtilis}
mdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseelatqkaq
gfvtfdkllalfagqlnekldvhetifalyeqglyqelmevfidimkhfd

SCOP Domain Coordinates for d1sedb_:

Click to download the PDB-style file with coordinates for d1sedb_.
(The format of our PDB-style files is described here.)

Timeline for d1sedb_: