Lineage for d1sedb_ (1sed B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737745Fold a.219: Hypothetical protein YhaI [109914] (1 superfamily)
    core: 5 helices; orthogonal array; folding similarity to the TipA-S domain (1ny9)
  4. 2737746Superfamily a.219.1: Hypothetical protein YhaI [109915] (1 family) (S)
    oligomerizes via extra N-terminal helix forming trimeric coil-coiled
    automatically mapped to Pfam PF08963
  5. 2737747Family a.219.1.1: Hypothetical protein YhaI [109916] (1 protein)
  6. 2737748Protein Hypothetical protein YhaI [109917] (1 species)
  7. 2737749Species Bacillus subtilis [TaxId:1423] [109918] (1 PDB entry)
    Uniprot O07517
  8. 2737751Domain d1sedb_: 1sed B: [105450]
    Structural genomics target
    complexed with gol, mpd, na, zn

Details for d1sedb_

PDB Entry: 1sed (more details), 2.1 Å

PDB Description: Crystal Structure of Protein of Unknown Function YhaL from Bacillus subtilis
PDB Compounds: (B:) Hypothetical protein yhaI

SCOPe Domain Sequences for d1sedb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sedb_ a.219.1.1 (B:) Hypothetical protein YhaI {Bacillus subtilis [TaxId: 1423]}
mdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseelatqkaq
gfvtfdkllalfagqlnekldvhetifalyeqglyqelmevfidimkhfd

SCOPe Domain Coordinates for d1sedb_:

Click to download the PDB-style file with coordinates for d1sedb_.
(The format of our PDB-style files is described here.)

Timeline for d1sedb_: