Class a: All alpha proteins [46456] (289 folds) |
Fold a.219: Hypothetical protein YhaI [109914] (1 superfamily) core: 5 helices; orthogonal array; folding similarity to the TipA-S domain (1ny9) |
Superfamily a.219.1: Hypothetical protein YhaI [109915] (1 family) oligomerizes via extra N-terminal helix forming trimeric coil-coiled automatically mapped to Pfam PF08963 |
Family a.219.1.1: Hypothetical protein YhaI [109916] (1 protein) |
Protein Hypothetical protein YhaI [109917] (1 species) |
Species Bacillus subtilis [TaxId:1423] [109918] (1 PDB entry) Uniprot O07517 |
Domain d1seda_: 1sed A: [105449] Structural genomics target complexed with gol, mpd, na, zn |
PDB Entry: 1sed (more details), 2.1 Å
SCOPe Domain Sequences for d1seda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1seda_ a.219.1.1 (A:) Hypothetical protein YhaI {Bacillus subtilis [TaxId: 1423]} dsmdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseelatqk aqgfvtfdkllalfagqlnekldvhetifalyeqglyqelmevfidimkhfd
Timeline for d1seda_: