SCOPe 2.06: Domain d1seda_: 1sed A:

Lineage for d1seda_ (1sed A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.219: Hypothetical protein YhaI [109914] (1 superfamily)
   core: 5 helices; orthogonal array; folding similarity to the TipA-S domain (1ny9)

4. Superfamily a.219.1: Hypothetical protein YhaI [109915] (1 family)
   oligomerizes via extra N-terminal helix forming trimeric coil-coiled
   automatically mapped to Pfam PF08963

5. Family a.219.1.1: Hypothetical protein YhaI [109916] (1 protein)

6. Protein Hypothetical protein YhaI [109917] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [109918] (1 PDB entry)
   Uniprot O07517

8. Domain d1seda_: 1sed A: [105449]
   Structural genomics target
   complexed with gol, mpd, na, zn

Details for d1seda_

PDB Entry: 1sed, 2.1 Å

PDB Description: Crystal Structure of Protein of Unknown Function YhaL from Bacillus subtilis

PDB Compounds: (A:) Hypothetical protein yhaI

SCOPe Domain Sequences for d1seda_:

Sequence; same for both SEQRES and ATOM records:

>d1seda_ a.219.1.1 (A:) Hypothetical protein YhaI {Bacillus subtilis [TaxId: 1423]}
dsmdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseelatqk
aqgfvtfdkllalfagqlnekldvhetifalyeqglyqelmevfidimkhfd

Timeline for d1seda_:

• d1seda_ first appeared in SCOP 1.69
  
• d1seda_ appears in SCOPe 2.05
  
• d1seda_ appears in SCOPe 2.07
  
• d1seda_ appears in the current release, SCOPe 2.08