Lineage for d1se8a_ (1se8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789342Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
    barrel, closed; n=5, S=10
  6. 2789438Protein ssDNA-binding protein [50264] (4 species)
  7. 2789439Species Deinococcus radiodurans [TaxId:1299] [110194] (1 PDB entry)
    Uniprot Q9RY51
  8. 2789440Domain d1se8a_: 1se8 A: [105448]
    multiple common domains: applies to families that are inconsistently divided into domains

Details for d1se8a_

PDB Entry: 1se8 (more details), 1.8 Å

PDB Description: Structure of single-stranded DNA-binding protein (SSB) from D. radiodurans
PDB Compounds: (A:) Single-strand binding protein

SCOPe Domain Sequences for d1se8a_:

Sequence, based on SEQRES records: (download)

>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]}
rgmnhvyligalardpelrytgngmavfeatvagedrvigndgrernlpwyhrvsilgkp
aewqaernlkggdavvvegtleyrqweapeggkrsavnvkalrmeqlgtqpeliqdaggg
vrmsgamnevlvlgnvtrdpeirytpagdavlslsiavnenyqdrqgqrqekvhyidatl
wrdlaenmkelrkgdpvmimgrlvnegwtdkdgnkrnstrveatrvealar

Sequence, based on observed residues (ATOM records): (download)

>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]}
rgmnhvyligalardpelrytgngmavfeatvagedrvrnlpwyhrvsilgkpaewqaer
nlkggdavvvegtleyrqwekrsavnvkalrmeqlgtqpeliqdagggvrmsgamnevlv
lgnvtrdpeirytpagdavlslsiavnenyqdrqgqrqekvhyidatlwrdlaenmkelr
kgdpvmimgrlvnegwtrnstrveatrvealar

SCOPe Domain Coordinates for d1se8a_:

Click to download the PDB-style file with coordinates for d1se8a_.
(The format of our PDB-style files is described here.)

Timeline for d1se8a_: