![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins) barrel, closed; n=5, S=10 |
![]() | Protein ssDNA-binding protein [50264] (4 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [110194] (1 PDB entry) Uniprot Q9RY51 |
![]() | Domain d1se8a_: 1se8 A: [105448] multiple common domains: applies to families that are inconsistently divided into domains |
PDB Entry: 1se8 (more details), 1.8 Å
SCOPe Domain Sequences for d1se8a_:
Sequence, based on SEQRES records: (download)
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} rgmnhvyligalardpelrytgngmavfeatvagedrvigndgrernlpwyhrvsilgkp aewqaernlkggdavvvegtleyrqweapeggkrsavnvkalrmeqlgtqpeliqdaggg vrmsgamnevlvlgnvtrdpeirytpagdavlslsiavnenyqdrqgqrqekvhyidatl wrdlaenmkelrkgdpvmimgrlvnegwtdkdgnkrnstrveatrvealar
>d1se8a_ b.40.4.3 (A:) ssDNA-binding protein {Deinococcus radiodurans [TaxId: 1299]} rgmnhvyligalardpelrytgngmavfeatvagedrvrnlpwyhrvsilgkpaewqaer nlkggdavvvegtleyrqwekrsavnvkalrmeqlgtqpeliqdagggvrmsgamnevlv lgnvtrdpeirytpagdavlslsiavnenyqdrqgqrqekvhyidatlwrdlaenmkelr kgdpvmimgrlvnegwtrnstrveatrvealar
Timeline for d1se8a_: