![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
![]() | Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (587 PDB entries) Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167 |
![]() | Domain d1sdua_: 1sdu A: [105444] complexed with act, mk1, so4; mutant |
PDB Entry: 1sdu (more details), 1.25 Å
SCOPe Domain Sequences for d1sdua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sdua_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd qiiieiaghkaigtvlvgptpvniigrnlmtqigatlnf
Timeline for d1sdua_: