Lineage for d1sdtb_ (1sdt B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466492Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 466493Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 466494Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 466510Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 466511Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (166 PDB entries)
  8. 466525Domain d1sdtb_: 1sdt B: [105443]

Details for d1sdtb_

PDB Entry: 1sdt (more details), 1.3 Å

PDB Description: Crystal structures of HIV protease V82A and L90M mutants reveal changes in indinavir binding site.

SCOP Domain Sequences for d1sdtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sdtb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOP Domain Coordinates for d1sdtb_:

Click to download the PDB-style file with coordinates for d1sdtb_.
(The format of our PDB-style files is described here.)

Timeline for d1sdtb_: