SCOPe 2.02: Domain d1sdsc_: 1sds C:

Lineage for d1sdsc_ (1sds C:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Methanococcus jannaschii [TaxId:2190] [111033] (3 PDB entries)
   Uniprot P54066

8. Domain d1sdsc_: 1sds C: [105441]
   protein/RNA complex; complexed with ca, k

Details for d1sdsc_

PDB Entry: 1sds, 1.8 Å

PDB Description: structure of protein l7ae bound to a k-turn derived from an archaeal box h/aca srna

PDB Compounds: (C:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d1sdsc_:

Sequence; same for both SEQRES and ATOM records:

>d1sdsc_ d.79.3.1 (C:) Ribosomal protein L7ae {Methanococcus jannaschii [TaxId: 2190]}
vkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvahlpyl
ceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlk

Timeline for d1sdsc_:

• d1sdsc_ first appeared in SCOP 1.69
  
• d1sdsc_ appears in SCOPe 2.01
  
• d1sdsc_ appears in SCOPe 2.03
  
• d1sdsc_ appears in the current release, SCOPe 2.08