Lineage for d1sdsc_ (1sds C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 606051Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 606212Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 606213Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 606230Protein Ribosomal protein L7ae [55319] (4 species)
  7. 606254Species Archaeon Methanococcus jannaschii [TaxId:2190] [111033] (2 PDB entries)
  8. 606258Domain d1sdsc_: 1sds C: [105441]
    complexed with ca, k

Details for d1sdsc_

PDB Entry: 1sds (more details), 1.8 Å

PDB Description: structure of protein l7ae bound to a k-turn derived from an archaeal box h/aca srna

SCOP Domain Sequences for d1sdsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sdsc_ d.79.3.1 (C:) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii}
vkfkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvahlpyl
ceekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvlk

SCOP Domain Coordinates for d1sdsc_:

Click to download the PDB-style file with coordinates for d1sdsc_.
(The format of our PDB-style files is described here.)

Timeline for d1sdsc_: