Lineage for d1sdsb_ (1sds B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566729Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2566746Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2566813Species Methanococcus jannaschii [TaxId:2190] [111033] (3 PDB entries)
    Uniprot P54066
  8. 2566815Domain d1sdsb_: 1sds B: [105440]
    protein/RNA complex; complexed with ca, k

Details for d1sdsb_

PDB Entry: 1sds (more details), 1.8 Å

PDB Description: structure of protein l7ae bound to a k-turn derived from an archaeal box h/aca srna
PDB Compounds: (B:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d1sdsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sdsb_ d.79.3.1 (B:) Ribosomal protein L7ae {Methanococcus jannaschii [TaxId: 2190]}
fkvpeeiqkelldavakaqkikkganevtkavergiaklviiaedvkpeevvahlpylce
ekgipyayvaskqdlgkaaglevaassvaiinegdaeelkvliekvnvl

SCOPe Domain Coordinates for d1sdsb_:

Click to download the PDB-style file with coordinates for d1sdsb_.
(The format of our PDB-style files is described here.)

Timeline for d1sdsb_: