Lineage for d1sdma_ (1sdm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111627Protein Kinesin heavy chain-like protein [110548] (1 species)
  7. 2111628Species Potato (Solanum tuberosum) [TaxId:4113] [110549] (3 PDB entries)
    Uniprot Q41460 884-1252
  8. 2111631Domain d1sdma_: 1sdm A: [105438]
    complexed with adp, mg

Details for d1sdma_

PDB Entry: 1sdm (more details), 2.3 Å

PDB Description: Crystal structure of kinesin-like calmodulin binding protein
PDB Compounds: (A:) Kinesin heavy chain-like protein

SCOPe Domain Sequences for d1sdma_:

Sequence, based on SEQRES records: (download)

>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]}
kirvycrlrplcekeiiakernairsvdeftvehlwkddkakqhmydrvfdgnatqddvf
edtkylvqsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkkdsnkf
sfslkaymvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyeelktii
qrgseqrhttgtlmneqssrshlivsviiestnlqtqaiargklsfvdlagservkksgs
agnqlkeaqsinkslsalgdvisalssgnqhipyrnhkltmlmsdslggnaktlmfvnis
paesnldethnsltyasrvrsivndpsknvsskevarlkklvsywkeqagrkgddeelee
iqde

Sequence, based on observed residues (ATOM records): (download)

>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]}
kirvycrlrplcekeiiakernairsvdeftvehlwkddkakqhmydrvfdgnatqddvf
edtkylvqsavdgynvcifaygqtgsgktftiygadsnpgltpramselfrimkkdsnkf
sfslkaymvelyqdtlvdlllpkqakrlkldikkdskgmvsvenvtvvsistyeelktii
qrgseqrhttgtlmneqssrshlivsviiestnlqtqaiargklsfvdlagservkkeaq
sinkslsalgdvisalssgnqhipyrnhkltmlmsdslggnaktlmfvnispaesnldet
hnsltyasrvrsivndpsknvsskevarlkklvsyweleeiqde

SCOPe Domain Coordinates for d1sdma_:

Click to download the PDB-style file with coordinates for d1sdma_.
(The format of our PDB-style files is described here.)

Timeline for d1sdma_: