![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.198: YcfC-like [101321] (1 superfamily) multihelical; contains two buried central helices |
![]() | Superfamily a.198.1: YcfC-like [101322] (1 family) ![]() automatically mapped to Pfam PF04356 |
![]() | Family a.198.1.1: YcfC-like [101323] (1 protein) Pfam PF04356; DUF489 |
![]() | Protein Hypothetical protein YcfC [101324] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [101325] (2 PDB entries) Uniprot P25746 |
![]() | Domain d1sdia1: 1sdi A:2-213 [105437] Other proteins in same PDB: d1sdia2 Structural genomics target complexed with acy, mpd |
PDB Entry: 1sdi (more details), 1.65 Å
SCOPe Domain Sequences for d1sdia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sdia1 a.198.1.1 (A:2-213) Hypothetical protein YcfC {Escherichia coli [TaxId: 562]} aknyyditlalagicqsarlvqqlahqghcdadalhvslnsiidmnpsstlavfggsean lrvgletllgvlnassrqglnaeltrytlslmvlerklssakgaldtlgnringlqrqle hfdlqsetlmsamaaiyvdvisplgpriqvtgspavlqspqvqakvratllagiraavlw hqvgggrlqlmfsrnrlttqakqilahltpel
Timeline for d1sdia1: